(data stored in ACNUC7421 zone)

EMBL: CP001509.YAAY

CP001509.YAAY        Location/Qualifiers
FT   CDS             25253..25471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaY"
FT                   /locus_tag="ECD_00028"
FT                   /product="uncharacterized protein"
FT                   /note="similar to b0024"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41930"
FT                   /protein_id="ACT41930.1"
FT                   /translation="MCRHSLRSDGAGFYQLAGCEYSFSAIKIAAGGQFLPVICAMAMKS
FT                   HFFLISVLNRRLTLTAVQGILGRFSLF"
     MCRHSLRSDG AGFYQLAGCE YSFSAIKIAA GGQFLPVICA MAMKSHFFLI SVLNRRLTLT        60
     AVQGILGRFS LF                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page