(data stored in ACNUC7421 zone)

EMBL: CP001509.YABI

CP001509.YABI        Location/Qualifiers
FT   CDS             74156..74920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="ECD_00067"
FT                   /product="DedA family inner membrane protein"
FT                   /note="similar to b0065"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41968"
FT                   /protein_id="ACT41968.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWHAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLATAVFVWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLIRHPLMPVYIDILRKVVGV"
     MQALLEHFIT QSTVYSLMAV VLVAFLESLA LVGLILPGTV LMAGLGALIG SGELSFWHAW        60
     LAGIVGCLLG DWISFWLGWR FKKPLHRWSF LKKNKALLDK TEHALHQHSM FTILVGRFVG       120
     PTRPLVPMVA GMLDLPVAKF ITPNIIGCLL WPPFYFLPGI LAGAAIDIPA GMQSGEFKWL       180
     LLATAVFVWV GGWLCWRLWR SGKATDRLSH YLSRGRLLWL TPLISAIGVV ALVVLIRHPL       240
     MPVYIDILRK VVGV                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page