(data stored in ACNUC7421 zone)

EMBL: CP001509.YACH

CP001509.YACH        Location/Qualifiers
FT   CDS             complement(132212..134065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="ECD_00116"
FT                   /product="DUF3300 family protein"
FT                   /note="similar to b0117"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42017"
FT                   /protein_id="ACT42017.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASTGLYIKSRTVEAPVEPQSTQL
FT                   AVSDAAAVTFPATVSAPPVTPAVVKSAFSTAQIDQWVAPVALYPDALLSQVLMASTYPT
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKAVPVKQTVTAPVIPSNTVLT
FT                   ANPVITEPATTVISIEPANPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFVDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDDYHHHDGGHRDGNGWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWRHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRQAAANQFQQRTHAAPVITRDTQRQAAAQRFNEAEHYGSYDDFHDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAVRERMQTNPKIQQRREAARERIQSASPEQRQAVREKMQTN
FT                   PQNQQRRDAARERIQSASPEQRQVFKEKVQQRPLNQQQRDNARQRVQSASPEQRQVFRE
FT                   KVQESRPQRLNDSNHTVRLNNEQRSAVRERLSERGARRLER"
     MKMTLPFKPH VLALICSAGL CAASTGLYIK SRTVEAPVEP QSTQLAVSDA AAVTFPATVS        60
     APPVTPAVVK SAFSTAQIDQ WVAPVALYPD ALLSQVLMAS TYPTNVAQAV QWSHDNPLKQ       120
     GDAAIQAVSD QPWDASVKSL VAFPQLMALM GENPQWVQNL GDAFLAQPQD VMDSVQRLRQ       180
     LAQQTGSLKS STEQKVITTT KKAVPVKQTV TAPVIPSNTV LTANPVITEP ATTVISIEPA       240
     NPDVVYIPNY NPTVVYGNWA NTAYPPVYLP PPAGEPFVDS FVRGFGYSMG VATTYALFSS       300
     IDWDDDDHDH HHHDDDDYHH HDGGHRDGNG WQHNGDNINI DVNNFNRITG EHLTDKNMAW       360
     RHNPNYRNGV PYHDQDMAKR FHQTDVNGGM SATQLPAPTR DSQRQAAANQ FQQRTHAAPV       420
     ITRDTQRQAA AQRFNEAEHY GSYDDFHDFS RRQPLTQQQK DAARQRYQSA SPEQRQAVRE       480
     RMQTNPKIQQ RREAARERIQ SASPEQRQAV REKMQTNPQN QQRRDAARER IQSASPEQRQ       540
     VFKEKVQQRP LNQQQRDNAR QRVQSASPEQ RQVFREKVQE SRPQRLNDSN HTVRLNNEQR       600
     SAVRERLSER GARRLER                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page