(data stored in ACNUC7421 zone)

EMBL: CP001509.YACL

CP001509.YACL        Location/Qualifiers
FT   CDS             137192..137554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="ECD_00118"
FT                   /product="UPF0231 family protein"
FT                   /note="similar to b0119"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42019"
FT                   /protein_id="ACT42019.1"
FT                   /translation="MDYEFLRDITGVVKVRMSMGHEVVGHWFNEEVKENLALLDEVEQA
FT                   AHALKGSERSWQRAGHEYTLWMDGEEVMVRANQLEFAGDEMEEGMNYYDEESLSLCGVE
FT                   DFLQVVAAYRNFVQQK"
     MDYEFLRDIT GVVKVRMSMG HEVVGHWFNE EVKENLALLD EVEQAAHALK GSERSWQRAG        60
     HEYTLWMDGE EVMVRANQLE FAGDEMEEGM NYYDEESLSL CGVEDFLQVV AAYRNFVQQK       120
//

If you have problems or comments...

PBIL Back to PBIL home page