(data stored in ACNUC7421 zone)

EMBL: CP001509.YADC

CP001509.YADC        Location/Qualifiers
FT   CDS             complement(152518..153864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadC"
FT                   /locus_tag="ECD_00134"
FT                   /product="putative fimbrial-like adhesin protein"
FT                   /note="similar to b0135"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42035"
FT                   /protein_id="ACT42035.1"
FT                   /translation="MMCTTNNRSKQITATVTAVDGGVIMKKFFRHFLFLILCLSCYTAS
FT                   AGTDDNVGYIVGNSYGVGPSDQKWRETGPNGDATVIFRYATSTNNLVFYKPTQLGPTGV
FT                   KLQWSQLDTASGGGFLYCNRSDSTSGSAMRIENAMVDSGKMYGSHKLFNTSVPGLYYTL
FT                   LISNMWSAYGTVTNVSSPGIYIGDSAEQYFSWYNPSEDVLYWSCNNANSTRKYWAVGGI
FT                   YQTLTIEFYTDTNFDPTVTQQIKLSSSSNYLYSFKAYGAGQGINEHSYFIKIDFDLLNV
FT                   KLTNPTCFTAMLSGTSVTGSTVKMGEYSAEQIRNGATPVPFDISLQNCVRVTNIETKLV
FT                   STKVGTENGQLLGNTLTGNDAAKGVGVLIEGLATSKNPLMTLKPNDSNSVYKDYDPRGK
FT                   DDTTGGVYPDQDTGITYPLHFQATLQQDGTIPIEAGEFKATSTFQVTYP"
     MMCTTNNRSK QITATVTAVD GGVIMKKFFR HFLFLILCLS CYTASAGTDD NVGYIVGNSY        60
     GVGPSDQKWR ETGPNGDATV IFRYATSTNN LVFYKPTQLG PTGVKLQWSQ LDTASGGGFL       120
     YCNRSDSTSG SAMRIENAMV DSGKMYGSHK LFNTSVPGLY YTLLISNMWS AYGTVTNVSS       180
     PGIYIGDSAE QYFSWYNPSE DVLYWSCNNA NSTRKYWAVG GIYQTLTIEF YTDTNFDPTV       240
     TQQIKLSSSS NYLYSFKAYG AGQGINEHSY FIKIDFDLLN VKLTNPTCFT AMLSGTSVTG       300
     STVKMGEYSA EQIRNGATPV PFDISLQNCV RVTNIETKLV STKVGTENGQ LLGNTLTGND       360
     AAKGVGVLIE GLATSKNPLM TLKPNDSNSV YKDYDPRGKD DTTGGVYPDQ DTGITYPLHF       420
     QATLQQDGTI PIEAGEFKAT STFQVTYP                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page