(data stored in ACNUC7421 zone)

EMBL: CP001509.YADD

CP001509.YADD        Location/Qualifiers
FT   CDS             149772..150674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadD"
FT                   /locus_tag="ECD_00131"
FT                   /product="transposase_31 family protein"
FT                   /note="similar to b0132"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42032"
FT                   /protein_id="ACT42032.1"
FT                   /translation="MDAPSTTPHDAVFKQFLMHAETARDFLEIHLPVELRELCDLNTLH
FT                   LESGSFIEESLKGHSTDVLYSVQMQGNPGYLHVVIEHQSKPDKKMAFRMMRYSIAAMHR
FT                   HLEADHDKLPLVVPILFYQGEATPYPLSMCWFDMFYSPELARRVYNSPFPLVDITITPD
FT                   DEIMQHRRIAILELLQKHIRQRDLMLLLEQLVTLIDEGYTSGSQLVAMQNYMLQRGHTE
FT                   QADLFYGVLRDRETGGESMMTLAQWFEEKGIEKGIQQGRQEVSQEFAQRLLSKGMSRED
FT                   VAEMANLPLAEIDKVINLI"
     MDAPSTTPHD AVFKQFLMHA ETARDFLEIH LPVELRELCD LNTLHLESGS FIEESLKGHS        60
     TDVLYSVQMQ GNPGYLHVVI EHQSKPDKKM AFRMMRYSIA AMHRHLEADH DKLPLVVPIL       120
     FYQGEATPYP LSMCWFDMFY SPELARRVYN SPFPLVDITI TPDDEIMQHR RIAILELLQK       180
     HIRQRDLMLL LEQLVTLIDE GYTSGSQLVA MQNYMLQRGH TEQADLFYGV LRDRETGGES       240
     MMTLAQWFEE KGIEKGIQQG RQEVSQEFAQ RLLSKGMSRE DVAEMANLPL AEIDKVINLI       300
//

If you have problems or comments...

PBIL Back to PBIL home page