(data stored in ACNUC7421 zone)

EMBL: CP001509.YADI

CP001509.YADI        Location/Qualifiers
FT   CDS             147381..147821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="ECD_00128"
FT                   /product="putative PTS Enzyme IIA"
FT                   /note="similar to b0129"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42029"
FT                   /protein_id="ACT42029.1"
FT                   /translation="MLGWVITCHDDRAQEMLDALEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGAPEVSSLWHQQQKNPPFVLKHNLYEY"
     MLGWVITCHD DRAQEMLDAL EKKHGALLQC RAVNFWRGLS SNMLSRMMCD ALHEADSGEG        60
     VIFLTDIAGA PPYRVASLLS HKHSRCEVIS GVTLPLIEQM MACRETMTSS EFRERIVELG       120
     APEVSSLWHQ QQKNPPFVLK HNLYEY                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page