(data stored in ACNUC7421 zone)

EMBL: CP001509.YADL

CP001509.YADL        Location/Qualifiers
FT   CDS             complement(154468..155070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadL"
FT                   /locus_tag="ECD_00136"
FT                   /product="putative fimbrial-like adhesin protein"
FT                   /note="similar to b0137"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42037"
FT                   /protein_id="ACT42037.1"
FT                   /translation="MTFKNLRYGLSSSVVLAASLFSVPSYAATDSIGLTVITTVEIGTC
FT                   TATLVNDSDQDISVVDFGDVYISEINAKTKVKTFKLKFKDCAGIPNKKAQIKLTKRATC
FT                   EGTANDGAGFANGSTAADKASAVAVEVWSTETPATGSATQFSCVTPASQEVTISNAANA
FT                   VVYYPMSARLVVEKNKTVSNVTAGKFSAPATFTVTYN"
     MTFKNLRYGL SSSVVLAASL FSVPSYAATD SIGLTVITTV EIGTCTATLV NDSDQDISVV        60
     DFGDVYISEI NAKTKVKTFK LKFKDCAGIP NKKAQIKLTK RATCEGTAND GAGFANGSTA       120
     ADKASAVAVE VWSTETPATG SATQFSCVTP ASQEVTISNA ANAVVYYPMS ARLVVEKNKT       180
     VSNVTAGKFS APATFTVTYN                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page