(data stored in ACNUC7421 zone)

EMBL: CP001509.YADM

CP001509.YADM        Location/Qualifiers
FT   CDS             complement(155085..155654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadM"
FT                   /locus_tag="ECD_00137"
FT                   /product="putative fimbrial-like adhesin protein"
FT                   /note="similar to b0138"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00137"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42038"
FT                   /protein_id="ACT42038.1"
FT                   /translation="MIKITPHKIAILMGILLSPSVFATDINVEFTATVKATTCNITLTG
FT                   NNVTNDGNNNYTLRIPKMGLDKIANKTTESQADFKLVASGCSSGISWIDTTLTGNASSS
FT                   SPKLIIPQSGDSSSTTSNIGMGFKKRTTDDATFLKPNSAEKIRWSTDEMQPDKGLEMTV
FT                   ALRETDAGQGVPGNFRALATFNFIYQ"
     MIKITPHKIA ILMGILLSPS VFATDINVEF TATVKATTCN ITLTGNNVTN DGNNNYTLRI        60
     PKMGLDKIAN KTTESQADFK LVASGCSSGI SWIDTTLTGN ASSSSPKLII PQSGDSSSTT       120
     SNIGMGFKKR TTDDATFLKP NSAEKIRWST DEMQPDKGLE MTVALRETDA GQGVPGNFRA       180
     LATFNFIYQ                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page