(data stored in ACNUC7421 zone)

EMBL: CP001509.YADN

CP001509.YADN        Location/Qualifiers
FT   CDS             complement(159151..159735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="ECD_00140"
FT                   /product="putative fimbrial-like adhesin protein"
FT                   /note="similar to b0141"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42041"
FT                   /protein_id="ACT42041.1"
FT                   /translation="MSKKLGFALSGLMLAMVAGTASADMDGGQLNISGLVVDNTCETRV
FT                   DGGNKDGLILLQTATVGETDAGVLNDTVGAKAKPFSITVDCSKANPNPGSTAKMTFGSV
FT                   FFGNSKGTLNNDMSINNPSDGVNIALHNIDGSTIKQVQINNPGDVYTKALDATTKSAVY
FT                   DFKASYVRAVADQTATAGYVKTNTAYTITYQ"
     MSKKLGFALS GLMLAMVAGT ASADMDGGQL NISGLVVDNT CETRVDGGNK DGLILLQTAT        60
     VGETDAGVLN DTVGAKAKPF SITVDCSKAN PNPGSTAKMT FGSVFFGNSK GTLNNDMSIN       120
     NPSDGVNIAL HNIDGSTIKQ VQINNPGDVY TKALDATTKS AVYDFKASYV RAVADQTATA       180
     GYVKTNTAYT ITYQ                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page