(data stored in ACNUC7421 zone)

EMBL: CP001509.YAEH

CP001509.YAEH        Location/Qualifiers
FT   CDS             complement(186552..186938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="ECD_00162"
FT                   /product="UPF0325 family protein"
FT                   /note="similar to b0163"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42063"
FT                   /protein_id="ACT42063.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
     MYDNLKSLGI TNPEEIDRYS LRQEANNDIL KIYFQKDKGE FFAKSVKFKY PRQRKTVVAD        60
     GVGQGYKEVQ EISPNLRYII DELDQICQRD RSEVDLKRKI LDDLRHLESV VTNKISEIEA       120
     DLEKLTRK                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page