(data stored in ACNUC7421 zone)

EMBL: CP001509.YAEI

CP001509.YAEI        Location/Qualifiers
FT   CDS             complement(187100..187912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeI"
FT                   /locus_tag="ECD_00163"
FT                   /product="phosphodiesterase with model substrate bis-pNPP"
FT                   /note="similar to b0164"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42064"
FT                   /protein_id="ACT42064.1"
FT                   /translation="MISRRCLLLAAAATLTAGSGFGYMRYWEPGWLELTHQRIAFFKDK
FT                   AAPFKILFLADLHYSRFVPLSLISDAIALGIEQKPDLILLGGDYVLFDMPLNFSAFSNV
FT                   LSPLAECAPTFACFGNHDRPVGTEKNHLIGETLKSVGITVLFNQATVIATPNRQFELVG
FT                   TGDLWAGQCKPPPASEANLPRLMLAHNPDSKEVMRDEPWDLMLCGHTHGGQLRVPLVGE
FT                   PFAPVEDKRYVAGLNAFGERHIYTTRGVGSLYGLRLNCRPEVTMLELV"
     MISRRCLLLA AAATLTAGSG FGYMRYWEPG WLELTHQRIA FFKDKAAPFK ILFLADLHYS        60
     RFVPLSLISD AIALGIEQKP DLILLGGDYV LFDMPLNFSA FSNVLSPLAE CAPTFACFGN       120
     HDRPVGTEKN HLIGETLKSV GITVLFNQAT VIATPNRQFE LVGTGDLWAG QCKPPPASEA       180
     NLPRLMLAHN PDSKEVMRDE PWDLMLCGHT HGGQLRVPLV GEPFAPVEDK RYVAGLNAFG       240
     ERHIYTTRGV GSLYGLRLNC RPEVTMLELV                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page