(data stored in ACNUC7421 zone)

EMBL: CP001509.YAEQ

CP001509.YAEQ        Location/Qualifiers
FT   CDS             217134..217679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="ECD_00189"
FT                   /product="PDDEXK superfamily protein"
FT                   /note="similar to b0190"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42090"
FT                   /protein_id="ACT42090.1"
FT                   /translation="MALKATIYKATVNVADLDRNQFLDASLTLARHPSETQERMMLRLL
FT                   AWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVAL
FT                   FTYNSRAAQIWWQQNQSKCVQFANLSVWYLDDEQLAKVSAFADRTMTLQATIQDGVIWL
FT                   SDDKNNLEVNLTAWQQPS"
     MALKATIYKA TVNVADLDRN QFLDASLTLA RHPSETQERM MLRLLAWLKY ADERLQFTRG        60
     LCADDEPEAW LRNDHLGIDL WIELGLPDER RIKKACTQAA EVALFTYNSR AAQIWWQQNQ       120
     SKCVQFANLS VWYLDDEQLA KVSAFADRTM TLQATIQDGV IWLSDDKNNL EVNLTAWQQP       180
     S                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page