(data stored in ACNUC7421 zone)

EMBL: CP001509.YAFJ

CP001509.YAFJ        Location/Qualifiers
FT   CDS             248901..249668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="ECD_00218"
FT                   /product="type 2 glutamine amidotransferase family protein"
FT                   /note="similar to b0223"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42119"
FT                   /protein_id="ACT42119.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSFNSPIAKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLTGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMAAVFKYIASLA
FT                   DELRAKGVFNMLLSDGRYVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWRLFCLGERVV"
     MCELLGMSAN VPTDICFSFT GLVQRGGGTG PHKDGWGITF YEGKGCRTFK DPQPSFNSPI        60
     AKLVQDYPIK SCSVVAHIRQ ANRGEVALEN THPFTRELWG RNWTYAHNGQ LTGYKSLETG       120
     NFRPVGETDS EKAFCWLLHK LTQRYPRTPG NMAAVFKYIA SLADELRAKG VFNMLLSDGR       180
     YVMAYCSTNL HWITRRAPFG VATLLDQDVE IDFSSQTTPN DVVTVIATQP LTGNETWQKI       240
     MPGEWRLFCL GERVV                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page