(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHC

CP001509.YAHC        Location/Qualifiers
FT   CDS             complement(304153..304650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahC"
FT                   /locus_tag="ECD_00273"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to b0317"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00273"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42172"
FT                   /protein_id="ACT42172.1"
FT                   /translation="MNGLTATGVTVGICAGLWQLVSSHVGLSQGWELLGTIGFVAFCSF
FT                   YAAGGGKSGFIRSLAVNYSGMVWAFFAALAAGWLASVSGLSAFWASVITTVPFSAVVVW
FT                   QGRFWLLSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGIISEYGGQKLSEATTKRD
FT                   GY"
     MNGLTATGVT VGICAGLWQL VSSHVGLSQG WELLGTIGFV AFCSFYAAGG GKSGFIRSLA        60
     VNYSGMVWAF FAALAAGWLA SVSGLSAFWA SVITTVPFSA VVVWQGRFWL LSFIPGGFLG       120
     MTLFFASGMN WTVTLLGFLA GNCVGIISEY GGQKLSEATT KRDGY                       165
//

If you have problems or comments...

PBIL Back to PBIL home page