(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHD

CP001509.YAHD        Location/Qualifiers
FT   CDS             304908..305513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahD"
FT                   /locus_tag="ECD_00274"
FT                   /product="ankyrin repeat protein"
FT                   /note="similar to b0318"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42173"
FT                   /protein_id="ACT42173.1"
FT                   /translation="MSIKNLPADYLLAAQQGDIDKVKTCLALGVDINTCDRQGKTAITL
FT                   ASLYQQYACVQALIDAGADINKQDHTCLNPFLISCLNDDLTLLRIILPAKPDLNCVTRF
FT                   GGVGLTPACEKGHLSIVKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLL
FT                   LEHGASPHLTDKYGKTPLELARERGFEEIAQLLIAAGA"
     MSIKNLPADY LLAAQQGDID KVKTCLALGV DINTCDRQGK TAITLASLYQ QYACVQALID        60
     AGADINKQDH TCLNPFLISC LNDDLTLLRI ILPAKPDLNC VTRFGGVGLT PACEKGHLSI       120
     VKELLAHTEI NVNQTNHVGW TPLLEAIVLN DGGIKQQAIV QLLLEHGASP HLTDKYGKTP       180
     LELARERGFE EIAQLLIAAG A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page