(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHG

CP001509.YAHG        Location/Qualifiers
FT   CDS             307953..309371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="ECD_00277"
FT                   /product="DUF1116 family protein"
FT                   /note="similar to b0321"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42176"
FT                   /protein_id="ACT42176.1"
FT                   /translation="MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQLDWTPPGQGNMQ
FT                   VVQALDNIADSPLADKIAAANQQALERIIQSHPVLIGFDQAINVVPGMTPKTILHAGPP
FT                   ITWEKMCGAMKGAVTGALVFEGLAKDLDEATELAASGEITFSPCHEHDCVGSMAGVTSA
FT                   SMFMHIVKNKTYGNIAYTNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPILRDAMKII
FT                   GEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVEQQREVFEFVASSD
FT                   YFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGP
FT                   MFAGYKPEDSGLDIGDSAITETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITL
FT                   GENPNVTIPLLGFMGVPSAIDITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFAC
FT                   FEKAILGWCERYGV"
     MSQSLFSQPL NVINVGIAMF SDDLKKQHVE VTQLDWTPPG QGNMQVVQAL DNIADSPLAD        60
     KIAAANQQAL ERIIQSHPVL IGFDQAINVV PGMTPKTILH AGPPITWEKM CGAMKGAVTG       120
     ALVFEGLAKD LDEATELAAS GEITFSPCHE HDCVGSMAGV TSASMFMHIV KNKTYGNIAY       180
     TNMSEQMAKI LRMGANDQSV IDRLNWMRDV QGPILRDAMK IIGEIDLRLM LAQALHMGDE       240
     CHNRNNAGTT LLIQALTPGI IQAGYSVEQQ REVFEFVASS DYFSGPTWMA MCKAAMDAAH       300
     GIEYSTVVTT MARNGVEFGL RVSGLPGQWF TGPAQQVIGP MFAGYKPEDS GLDIGDSAIT       360
     ETYGIGGFAM ATAPAIVALV GGTVEEAIDF SRQMREITLG ENPNVTIPLL GFMGVPSAID       420
     ITRVGSSGIL PVINTAIAHK DAGVGMIGAG IVHPPFACFE KAILGWCERY GV               472
//

If you have problems or comments...

PBIL Back to PBIL home page