(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHI

CP001509.YAHI        Location/Qualifiers
FT   CDS             309793..310743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="ECD_00278"
FT                   /product="carbamate kinase-like protein"
FT                   /note="similar to b0323"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42177"
FT                   /protein_id="ACT42177.1"
FT                   /translation="MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDY
FT                   DIVLTHGNGPQVGLDLRRAEIAHEREGLPLTPLANCVADTQGGIGYLIQQALNNRLARH
FT                   GEKKAVTVVTQVEVDKNDPGFAHPTKPIGAFFSDSQRDELQKANPDWCFVEDAGRGYRR
FT                   VVASPEPKRIVEAPAIKALIQQGFVVIGAGGGGIPVVRTDAGDYQSVDAVIDKDPSTAL
FT                   LAREIHADILVITTGVEKVCIHFGKPQQQALDRVDIATMTRYMQEGHFPPGSMLPKIIA
FT                   SLTFLEQGGKEVIITTPECLPAALRGETGTHIIKT"
     MKELVVVAIG GNSIIKDNAS QSIEHQAEAV KAVADTVLEM LASDYDIVLT HGNGPQVGLD        60
     LRRAEIAHER EGLPLTPLAN CVADTQGGIG YLIQQALNNR LARHGEKKAV TVVTQVEVDK       120
     NDPGFAHPTK PIGAFFSDSQ RDELQKANPD WCFVEDAGRG YRRVVASPEP KRIVEAPAIK       180
     ALIQQGFVVI GAGGGGIPVV RTDAGDYQSV DAVIDKDPST ALLAREIHAD ILVITTGVEK       240
     VCIHFGKPQQ QALDRVDIAT MTRYMQEGHF PPGSMLPKII ASLTFLEQGG KEVIITTPEC       300
     LPAALRGETG THIIKT                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page