(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHJ

CP001509.YAHJ        Location/Qualifiers
FT   CDS             310753..312135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahJ"
FT                   /locus_tag="ECD_00279"
FT                   /product="putative metallo-dependent hydrolase domain
FT                   deaminase"
FT                   /note="similar to b0324"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42178"
FT                   /protein_id="ACT42178.1"
FT                   /translation="MKESNSRREFLSQSGKMVTAAALFGTSVPLAHAAVAGTLNCEANN
FT                   TMKITDPHYYLDNVLLETGFDYENGVAVQTRTARQTVEIQDGKIVALRENKLHPDATLP
FT                   HYDAGGKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQ
FT                   ERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGL
FT                   LLSKSEPLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTP
FT                   AGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDELANRMVVQQISIASTVPI
FT                   GTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSL
FT                   FLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSV
FT                   AG"
     MKESNSRREF LSQSGKMVTA AALFGTSVPL AHAAVAGTLN CEANNTMKIT DPHYYLDNVL        60
     LETGFDYENG VAVQTRTARQ TVEIQDGKIV ALRENKLHPD ATLPHYDAGG KLMLPTTRDM       120
     HIHLDKTFYG GPWRSLNRPA GTTIQDMIKL EQKMLPELQP YTQERAEKLI DLLQSKGTTI       180
     ARSHCNIEPV SGLKNLQNLQ AVLARRQAGF ECEIVAFPQH GLLLSKSEPL MREAMQAGAH       240
     YVGGLDPTSV DGAMEKSLDT MFQIALDYDK GVDIHLHETT PAGVAAINYM VETVEKTPQL       300
     KGKLTISHAF ALATLNEQQV DELANRMVVQ QISIASTVPI GTLHMPLKQL HDKGVKVMTG       360
     TDSVIDHWSP YGLGDMLEKA NLYAQLYIRP NEQNLSRSLF LATGDVLPLN EKGERVWPKA       420
     QDDASFVLVD ASCSAEAVAR ISPRTATFHK GQLVWGSVAG                             460
//

If you have problems or comments...

PBIL Back to PBIL home page