(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHL

CP001509.YAHL        Location/Qualifiers
FT   CDS             313805..314620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahL"
FT                   /locus_tag="ECD_00281"
FT                   /product="uncharacterized protein"
FT                   /note="similar to b0326"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42180"
FT                   /protein_id="ACT42180.1"
FT                   /translation="MISLKAPHNNLMPYTQQSILNTVKNNQLPEDIKSSLVSCVDIFKV
FT                   LIKQYYDYPYDCRDDLVDDDKLIHLMAAVRDCEWSDDNALTINVQFNDFPGFYDWMDYP
FT                   DHPVKFVFHILENQKGTVWVYDQDDAFLDIKANVQAGRFTGLKKLVQFIDSVRTDCKCI
FT                   LLEYHMPLLRIFPKGKECMHVEKWLREMSSIPETDAPIKQALAHGLLLHLKNIYPVFPE
FT                   SLVMLLLSVLDVKTYRDDARLNEWISNRVQELGDRYYPVNKHVKIRYTL"
     MISLKAPHNN LMPYTQQSIL NTVKNNQLPE DIKSSLVSCV DIFKVLIKQY YDYPYDCRDD        60
     LVDDDKLIHL MAAVRDCEWS DDNALTINVQ FNDFPGFYDW MDYPDHPVKF VFHILENQKG       120
     TVWVYDQDDA FLDIKANVQA GRFTGLKKLV QFIDSVRTDC KCILLEYHMP LLRIFPKGKE       180
     CMHVEKWLRE MSSIPETDAP IKQALAHGLL LHLKNIYPVF PESLVMLLLS VLDVKTYRDD       240
     ARLNEWISNR VQELGDRYYP VNKHVKIRYT L                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page