(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHM

CP001509.YAHM        Location/Qualifiers
FT   CDS             315033..315278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahM"
FT                   /locus_tag="ECD_00282"
FT                   /product="uncharacterized protein"
FT                   /note="similar to b0327"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42181"
FT                   /protein_id="ACT42181.1"
FT                   /translation="MAVQLFKTLLNQIPLLSSLQSGTLPLFGYSGWGRPMKKAHTGESG
FT                   LKWEAKDSSKLIGNKDHALRGLSSPMAVIRQIRLIT"
     MAVQLFKTLL NQIPLLSSLQ SGTLPLFGYS GWGRPMKKAH TGESGLKWEA KDSSKLIGNK        60
     DHALRGLSSP MAVIRQIRLI T                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page