(data stored in ACNUC7421 zone)

EMBL: CP001509.YAHO

CP001509.YAHO        Location/Qualifiers
FT   CDS             316113..316388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="ECD_00284"
FT                   /product="periplasmic protein, function unknown, YhcN
FT                   family"
FT                   /note="similar to b0329"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00284"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42183"
FT                   /protein_id="ACT42183.1"
FT                   /translation="MKIISKMLVGALALAVTNVYAAELMTKAEFEKVESQYEKIGDIST
FT                   SNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTANIYKKK"
     MKIISKMLVG ALALAVTNVY AAELMTKAEF EKVESQYEKI GDISTSNEMS TADAKEDLIK        60
     KADEKGADVL VLTSGQTDNK IHGTANIYKK K                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page