(data stored in ACNUC7421 zone)

EMBL: CP001509.YAIE

CP001509.YAIE        Location/Qualifiers
FT   CDS             372802..373086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="ECD_00338"
FT                   /product="UPF0345 family protein"
FT                   /note="similar to b0391"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42237"
FT                   /protein_id="ACT42237.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
     MLQSNEYFSG KVKSIGFSSS STGRASVGVM VEGEYTFSTA EPEEMTVISG ALNVLLPDAT        60
     DWQVYEAGSV FNVPGHSEFH LQVAEPTSYL CRYL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page