(data stored in ACNUC7421 zone)

EMBL: CP001509.YAIL

CP001509.YAIL        Location/Qualifiers
FT   CDS             346107..346646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="ECD_00308"
FT                   /product="DUF2058 family protein"
FT                   /note="similar to b0354"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42207"
FT                   /protein_id="ACT42207.1"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDDPYADFKVPDDLMW"
     MAKLTLQEQL LKAGLVTSKK AAKVERTAKK SRVQAREARA AVEENKKAQL ERDKQLSEQQ        60
     KQAALAKEYK AQVKQLIEMN RITIANGDIG FNFTDGNLIK KIFVDKLTQA QLINGRLAIA       120
     RLLVDNNSEG EYAIIPASVA DKIAQRDASS IVLHSALSAE EQDEDDPYAD FKVPDDLMW        179
//

If you have problems or comments...

PBIL Back to PBIL home page