(data stored in ACNUC7421 zone)

EMBL: CP001509.YAIO

CP001509.YAIO        Location/Qualifiers
FT   CDS             complement(349403..350176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiO"
FT                   /locus_tag="ECD_00312"
FT                   /product="outer membrane protein"
FT                   /note="similar to b0358"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42211"
FT                   /protein_id="ACT42211.1"
FT                   /translation="MIKRTLLAAAIFSALPAYAGLTSITAGYDFTDYSGDHGNRNLAYA
FT                   ELVAKVENATLLFNLSQGRRDYETEHFNATRGQGAVWYKWNNWLTTRTGIAFADNTPVF
FT                   ARQDFRQDINLALLPKTLFTTGYRYTKYYDDVEVDAWQGGVSLYTGPVITSYRYTHYDS
FT                   SDAGGSYSNMISVRLNDPRGTGYTQLWLSRGTGAYTYDWTPETRYGSMKSVSLQRIQPL
FT                   TEQLNLGLTAGKVWYDTPTDDYNGLQLAAHLTWKF"
     MIKRTLLAAA IFSALPAYAG LTSITAGYDF TDYSGDHGNR NLAYAELVAK VENATLLFNL        60
     SQGRRDYETE HFNATRGQGA VWYKWNNWLT TRTGIAFADN TPVFARQDFR QDINLALLPK       120
     TLFTTGYRYT KYYDDVEVDA WQGGVSLYTG PVITSYRYTH YDSSDAGGSY SNMISVRLND       180
     PRGTGYTQLW LSRGTGAYTY DWTPETRYGS MKSVSLQRIQ PLTEQLNLGL TAGKVWYDTP       240
     TDDYNGLQLA AHLTWKF                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page