(data stored in ACNUC7421 zone)

EMBL: CP001509.YAIT

CP001509.YAIT        Location/Qualifiers
FT   CDS             356137..359043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiT"
FT                   /locus_tag="ECD_00321"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0371-b0374"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42220"
FT                   /protein_id="ACT42220.1"
FT                   /translation="MHSWKKKLVVSQLALACTLAITSQANAANYDTWTYIDNPVTALDW
FT                   DHMDKAGTVDGNYVNYSGFVYYNNTNGDFDQSFNGDTVNGTISTYYLNHDYADSTANQL
FT                   DISNSVIHGSITSMLPGGYYDRFDADGNNLGGYDFYTDAVVDTHWRDGDVFTLNIANTT
FT                   IDDDYEALYFTDSYKDGDVTKHTNETFDTSEGVAVNLDVESNINISNNSRVAGIALSQG
FT                   NTYNETYTTESHTWDNNISVKDSTVTSGSNYILDSNTYGKTGHFGNSDEPSDYAGPGDV
FT                   AMSFTASGSDYAMKNNVFLSNSTLMGDVAFTSTWNSNFDPNGHDSNGDGVKDTNGGWTD
FT                   DSLNVDELNLTLDNGSKWVGQAIYNVAETSAMYDVATNSLTPDATYENNDWKRVVDDKV
FT                   FQSGVFNVALNNGSEWDTTGRSIVDTLTVNNGSQVNVSESKLTSDTIDLTNGSSLNIGE
FT                   DGYVDTDHLTINSYSTVALTESTGWGADYNLYANTITVTNGGVLDVNVDQFDTEAFRTD
FT                   KLELTSGNIADHNGNVVSGVFDIHSSDYVLNADLVNDRTWDTSKSNYGYGIVAMNSDGH
FT                   LTINGNGDVDNGTELDNSSVDNVVAATGNYKVRIDNATGAGAIADYKDKEIIYVNDVNS
FT                   NATFSAANKADLGAYTYQAEQRGNTVVLQQMELTDYANMALSIPSANTNIWNLEQDTVG
FT                   TRLTNSRHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDTKIDGNNAKWIVG
FT                   AAAGFAKGDMNDRSGQVDQDSQTAYIYSSAHFANNVFVDGSLSYSHFNNDLSATMSNGT
FT                   YVDGSTNSDAWGFGLKAGYDFKLGDAGYVTPYGSVSGLFQSGDDYQLSNDMKVDGQSYD
FT                   SMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDNDVNGDSIDNGTEGSAVRVGL
FT                   GTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
     MHSWKKKLVV SQLALACTLA ITSQANAANY DTWTYIDNPV TALDWDHMDK AGTVDGNYVN        60
     YSGFVYYNNT NGDFDQSFNG DTVNGTISTY YLNHDYADST ANQLDISNSV IHGSITSMLP       120
     GGYYDRFDAD GNNLGGYDFY TDAVVDTHWR DGDVFTLNIA NTTIDDDYEA LYFTDSYKDG       180
     DVTKHTNETF DTSEGVAVNL DVESNINISN NSRVAGIALS QGNTYNETYT TESHTWDNNI       240
     SVKDSTVTSG SNYILDSNTY GKTGHFGNSD EPSDYAGPGD VAMSFTASGS DYAMKNNVFL       300
     SNSTLMGDVA FTSTWNSNFD PNGHDSNGDG VKDTNGGWTD DSLNVDELNL TLDNGSKWVG       360
     QAIYNVAETS AMYDVATNSL TPDATYENND WKRVVDDKVF QSGVFNVALN NGSEWDTTGR       420
     SIVDTLTVNN GSQVNVSESK LTSDTIDLTN GSSLNIGEDG YVDTDHLTIN SYSTVALTES       480
     TGWGADYNLY ANTITVTNGG VLDVNVDQFD TEAFRTDKLE LTSGNIADHN GNVVSGVFDI       540
     HSSDYVLNAD LVNDRTWDTS KSNYGYGIVA MNSDGHLTIN GNGDVDNGTE LDNSSVDNVV       600
     AATGNYKVRI DNATGAGAIA DYKDKEIIYV NDVNSNATFS AANKADLGAY TYQAEQRGNT       660
     VVLQQMELTD YANMALSIPS ANTNIWNLEQ DTVGTRLTNS RHGLADNGGA WVSYFGGNFN       720
     GDNGTINYDQ DVNGIMVGVD TKIDGNNAKW IVGAAAGFAK GDMNDRSGQV DQDSQTAYIY       780
     SSAHFANNVF VDGSLSYSHF NNDLSATMSN GTYVDGSTNS DAWGFGLKAG YDFKLGDAGY       840
     VTPYGSVSGL FQSGDDYQLS NDMKVDGQSY DSMRYELGVD AGYTFTYSED QALTPYFKLA       900
     YVYDDSNNDN DVNGDSIDNG TEGSAVRVGL GTQFSFTKNF SAYTDANYLG GGDVDQDWSA       960
     NVGVKYTW                                                                968
//

If you have problems or comments...

PBIL Back to PBIL home page