(data stored in ACNUC7421 zone)

EMBL: CP001509.YAIW

CP001509.YAIW        Location/Qualifiers
FT   CDS             362497..363591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="ECD_00325"
FT                   /product="microcin Bac7 uptake protein; outer membrane
FT                   surface-exposed lipoprotein"
FT                   /note="similar to b0378"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42224"
FT                   /protein_id="ACT42224.1"
FT                   /translation="MSRVNPLSSLSLLAALVLAGCSSQAPQPLKKGEKAIDVASVVRQK
FT                   MPASVKDRDAWAKDLATTFESQGLAPTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQ
FT                   EIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVRTEKQLSAIFDDLISMVPMGQT
FT                   LFGSLNPVRTGGPMQVSIAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPA
FT                   SYSAPIYRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRK
FT                   LAGKLGMSDSEIRRQLEKGDSFSFEETALYKKVYQLAEAKTGKSLPREMLPGIQLESPK
FT                   ITRNLTTAWFAKRVDERRARCMKQ"
     MSRVNPLSSL SLLAALVLAG CSSQAPQPLK KGEKAIDVAS VVRQKMPASV KDRDAWAKDL        60
     ATTFESQGLA PTLENVCSVL AVAQQESNYQ ADPAVPGLSK IAWQEIDRRA ERMHIPAFLV       120
     HTALKIKSPN GKSYSERLDS VRTEKQLSAI FDDLISMVPM GQTLFGSLNP VRTGGPMQVS       180
     IAFAEQHTKG YPWKMDGTVR QEVFSRRGGL WFGTYHLLNY PASYSAPIYR FADFNAGWYA       240
     SRNAAFQNAV SKASGVKLAL DGDLIRYDSK EPGKTELATR KLAGKLGMSD SEIRRQLEKG       300
     DSFSFEETAL YKKVYQLAEA KTGKSLPREM LPGIQLESPK ITRNLTTAWF AKRVDERRAR       360
     CMKQ                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page