(data stored in ACNUC7421 zone)

EMBL: CP001509.YAIZ

CP001509.YAIZ        Location/Qualifiers
FT   CDS             364218..364430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="ECD_00327"
FT                   /product="DUF2754 family putative inner membrane protein"
FT                   /note="similar to b0380"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42226"
FT                   /protein_id="ACT42226.1"
FT                   /translation="MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGL
FT                   VTWVISFWLAGLIIRRRDEETENAQ"
     MNLPVKIRRD WHYYAFAIGL IFILNGVVGL LGFEAKGWQT YAVGLVTWVI SFWLAGLIIR        60
     RRDEETENAQ                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page