(data stored in ACNUC7421 zone)

EMBL: CP001509.YAJC

CP001509.YAJC        Location/Qualifiers
FT   CDS             392689..393021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="ECD_00355"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /note="similar to b0407"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42254"
FT                   /protein_id="ACT42254.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
     MSFFISDAVA ATGAPAQGSP MSLILMLVVF GLIFYFMILR PQQKRTKEHK KLMDSIAKGD        60
     EVLTNGGLVG RVTKVAENGY IAIALNDTTE VVIKRDFVAA VLPKGTMKAL                  110
//

If you have problems or comments...

PBIL Back to PBIL home page