(data stored in ACNUC7421 zone)

EMBL: CP001509.YAJD

CP001509.YAJD        Location/Qualifiers
FT   CDS             396006..396353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="ECD_00358"
FT                   /product="HNH nuclease family protein"
FT                   /note="similar to b0410"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42257"
FT                   /protein_id="ACT42257.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
     MAIIPKNYAR LESGYREKAL KIYPWVCGRC SREFVYSNLR ELTVHHIDHD HTNNPEDGSN        60
     WELLCLYCHD HEHSKYTEAD QYGTTVIAGE DAQKDVGEAK YNPFADLKAM MNKKK            115
//

If you have problems or comments...

PBIL Back to PBIL home page