(data stored in ACNUC7421 zone)

EMBL: CP001509.YAJQ

CP001509.YAJQ        Location/Qualifiers
FT   CDS             410084..410575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="ECD_00374"
FT                   /product="phage Phi6 host factor, ATP/GTP binding protein"
FT                   /note="similar to b0426"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42273"
FT                   /protein_id="ACT42273.1"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
FT                   "
     MPSFDIVSEV DLQEARNAVD NASREVESRF DFRNVEASFE LNDASKTIKV LSESDFQVNQ        60
     LLDILRAKLL KRGIEGSSLD VPENIVHSGK TWFVEAKLKQ GIESATQKKI VKMIKDSKLK       120
     VQAQIQGDEI RVTGKSRDDL QAVMAMVRGG DLGQPFQFKN FRD                         163
//

If you have problems or comments...

PBIL Back to PBIL home page