(data stored in ACNUC7421 zone)

EMBL: CP001509.YBAA

CP001509.YBAA        Location/Qualifiers
FT   CDS             445718..446071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="ECD_00407"
FT                   /product="DUF1428 family protein"
FT                   /note="similar to b0456"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42306"
FT                   /protein_id="ACT42306.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
     MKYVDGFVVA VPADKKDAYR EMAAKAAPLF KEFGALRIVE CWASDVPDGK VTDFRMAVKA        60
     EENEEVVFSW IEYPSKEVRD AANQKMMSDP RMKEFGESMP FDGKRMIYGG FESIIDE          117
//

If you have problems or comments...

PBIL Back to PBIL home page