(data stored in ACNUC7421 zone)

EMBL: CP001509.YBAB

CP001509.YBAB        Location/Qualifiers
FT   CDS             463122..463451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="ECD_00422"
FT                   /product="DNA-binding protein, putative nucleoid-associated
FT                   protein"
FT                   /note="similar to b0471"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42321"
FT                   /protein_id="ACT42321.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
     MFGKGGLGNL MKQAQQMQEK MQKMQEEIAQ LEVTGESGAG LVKVTINGAH NCRRVEIDPS        60
     LLEDDKEMLE DLVAAAFNDA ARRIEETQKE KMASVSSGMQ LPPGFKMPF                   109
//

If you have problems or comments...

PBIL Back to PBIL home page