(data stored in ACNUC7421 zone)

EMBL: CP001509.YBAE

CP001509.YBAE        Location/Qualifiers
FT   CDS             complement(434658..436358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="ECD_00397"
FT                   /product="putative ABC transporter periplasmic binding
FT                   protein"
FT                   /note="similar to b0445"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42296"
FT                   /protein_id="ACT42296.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGKPQTVTISELAERCFCSERHVRTLLR
FT                   QAQEAGWLEWQAQSGRGKCGQLRFLVTPESLRNAMMEQALETGKQQDVLELAQLAPGEL
FT                   RTLLQPFMGGQWQNDTPTLRIPYYRPLEPLQPGFLPGRAEQHLAGQIFSGLTRFDNNTQ
FT                   RPIGDLAHHWETSTDGLRWDFYLRSTLHWHNGDAVKASHLHQRLLMLLQLPALDQLFIS
FT                   VKRIEVTHPQCLTFFLHRPDYWLAHRLASYCSHLAHPQFPLIGTGPFRLTQFTAELVRL
FT                   ESHDYYHLRHPLLKAVEYWITPPLFEKDLGTSCRHPVQITIGKPEELQRVSQVSSGISL
FT                   GFCYLTLRKSPRLSLWQARKVISIIHQSGLLQTLEVGENLITASHALLPGWTIPHWQVP
FT                   DEVKLPKTLTLVYHLPIELHTMAERLQATLAAEGCELTIIFHNAKNWDDTTLLAHADLM
FT                   MGDRLIGEAPEYTLEQWLRCDPLWPHVFDAPAYAHLQSTLDAVQVMPDEENRFNALKAV
FT                   FSQLMADATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFTEAWLPAPSQ"
     MRLLNRLNQY QRLWQPSAGK PQTVTISELA ERCFCSERHV RTLLRQAQEA GWLEWQAQSG        60
     RGKCGQLRFL VTPESLRNAM MEQALETGKQ QDVLELAQLA PGELRTLLQP FMGGQWQNDT       120
     PTLRIPYYRP LEPLQPGFLP GRAEQHLAGQ IFSGLTRFDN NTQRPIGDLA HHWETSTDGL       180
     RWDFYLRSTL HWHNGDAVKA SHLHQRLLML LQLPALDQLF ISVKRIEVTH PQCLTFFLHR       240
     PDYWLAHRLA SYCSHLAHPQ FPLIGTGPFR LTQFTAELVR LESHDYYHLR HPLLKAVEYW       300
     ITPPLFEKDL GTSCRHPVQI TIGKPEELQR VSQVSSGISL GFCYLTLRKS PRLSLWQARK       360
     VISIIHQSGL LQTLEVGENL ITASHALLPG WTIPHWQVPD EVKLPKTLTL VYHLPIELHT       420
     MAERLQATLA AEGCELTIIF HNAKNWDDTT LLAHADLMMG DRLIGEAPEY TLEQWLRCDP       480
     LWPHVFDAPA YAHLQSTLDA VQVMPDEENR FNALKAVFSQ LMADATLTPL FNYHYRISAP       540
     PGVNGVRLTP RGWFEFTEAW LPAPSQ                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page