(data stored in ACNUC7421 zone)

EMBL: CP001509.YBAM

CP001509.YBAM        Location/Qualifiers
FT   CDS             complement(459156..459317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="ECD_00417"
FT                   /product="DUF2496 family protein"
FT                   /note="similar to b0466"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42316"
FT                   /protein_id="ACT42316.1"
FT                   /translation="MSLENAPDDVKLAVDLIVLLEENQIPASTVLRALDIVKRDYEKKL
FT                   TRDDEAEK"
     MSLENAPDDV KLAVDLIVLL EENQIPASTV LRALDIVKRD YEKKLTRDDE AEK               53
//

If you have problems or comments...

PBIL Back to PBIL home page