(data stored in ACNUC7421 zone)

EMBL: CP001509.YBAN

CP001509.YBAN        Location/Qualifiers
FT   CDS             459928..460305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="ECD_00419"
FT                   /product="DUF454 family inner membrane protein"
FT                   /note="similar to b0468"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42318"
FT                   /protein_id="ACT42318.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
     MQRIILIIIG WLAVVLGTLG VVLPVLPTTP FILLAAWCFA RSSPRFHAWL LYRSWFGSYL        60
     RFWQKHHAMP RGVKPRAILL ILLTFAISLW FVQMPWVRIM LLVILACLLF YMWRIPVIDE       120
     KQEKH                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page