(data stored in ACNUC7421 zone)

EMBL: CP001509.YBAP

CP001509.YBAP        Location/Qualifiers
FT   CDS             complement(476332..477126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="ECD_00433"
FT                   /product="TraB family protein"
FT                   /note="similar to b0482"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42332"
FT                   /protein_id="ACT42332.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDITLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEEQLQNLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEN
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMSWWLNAPPQNNDITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRAMPPGRYVVAVGALHLYGEGNLPQMLR"
     MDLLYRVKTL WAALRGNHYT WPAIDITLPG NRHFHLIGSI HMGSHDMAPL PTRLLKKLKN        60
     ADALIVEADV STSDTPFANL PACEALEERI SEEQLQNLQH ISQEMGISPS LFSTQPLWQI       120
     AMVLQATQAQ KLGLRAEYGI DYQLLQAAKQ QHKPVIELEG AENQIAMLLQ LPDKGLALLD       180
     DTLTHWHTNA RLLQQMMSWW LNAPPQNNDI TLPNTFSQSL YDVLMHQRNL AWRDKLRAMP       240
     PGRYVVAVGA LHLYGEGNLP QMLR                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page