(data stored in ACNUC7421 zone)

EMBL: CP001509.YBAV

CP001509.YBAV        Location/Qualifiers
FT   CDS             432971..433342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="ECD_00394"
FT                   /product="putative competence-suppressing periplasmic
FT                   helix-hairpin-helix DNA-binding protein"
FT                   /note="similar to b0442"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42293"
FT                   /protein_id="ACT42293.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAAPAAKPTTVETKAEAPAAQ
FT                   SKAAVLAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
     MKHGIKALLI TLSLACAGMS HSALAAAPAA KPTTVETKAE APAAQSKAAV LAKASDEEGT        60
     RVSINNASAE ELARAMNGVG LKKAQAIVSY REEYGPFKTV EDLKQVPGMG NSLVERNLAV       120
     LTL                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page