(data stored in ACNUC7421 zone)

EMBL: CP001509.YBAZ

CP001509.YBAZ        Location/Qualifiers
FT   CDS             complement(445028..445417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaZ"
FT                   /locus_tag="ECD_00406"
FT                   /product="excision repair protein, alkyltransferase-like
FT                   protein ATL"
FT                   /note="similar to b0454"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42305"
FT                   /protein_id="ACT42305.1"
FT                   /translation="MLVSCAMRLHSGVFPDYAEKLPQEEKMEKEDSFPQRVWQIVAAIP
FT                   EGYVTTYGDVAKLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQR
FT                   QALLAEGVMVSGSGQIDLQRYRWNY"
     MLVSCAMRLH SGVFPDYAEK LPQEEKMEKE DSFPQRVWQI VAAIPEGYVT TYGDVAKLAG        60
     SPRAARQVGG VLKRLPEGST LPWHRVVNRH GTISLTGPDL QRQRQALLAE GVMVSGSGQI       120
     DLQRYRWNY                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page