(data stored in ACNUC7421 zone)

EMBL: CP001509.YBBC

CP001509.YBBC        Location/Qualifiers
FT   CDS             496727..497095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbC"
FT                   /locus_tag="ECD_00449"
FT                   /product="putative immunity protein"
FT                   /note="similar to b0498"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42348"
FT                   /protein_id="ACT42348.1"
FT                   /translation="MKYSSIFSMLSFFILFACNETAVYGSDENIIFMRYVEKLHLDKYS
FT                   VKNTVKTETMAIQLAEIYVRYRYGERIAEEEKPYLITELPDSWVVEGAKLPYEVAGGVF
FT                   IIEINKKNGCVLNFLHSK"
     MKYSSIFSML SFFILFACNE TAVYGSDENI IFMRYVEKLH LDKYSVKNTV KTETMAIQLA        60
     EIYVRYRYGE RIAEEEKPYL ITELPDSWVV EGAKLPYEVA GGVFIIEINK KNGCVLNFLH       120
     SK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page