(data stored in ACNUC7421 zone)

EMBL: CP001509.YBBD

CP001509.YBBD        Location/Qualifiers
FT   CDS             497786..498046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbD"
FT                   /locus_tag="ECD_00451"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0500"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42350"
FT                   /protein_id="ACT42350.1"
FT                   /translation="MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYIN
FT                   YMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDYFFLIFP"
     MLAISSNLSK MIIFIFAIII IVVLCVITYL YLYKDESLVS KHYINYMAIP ENDGVFTWLP        60
     DFFPHVAVDI SIYTNVEDDY FFLIFP                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page