(data stored in ACNUC7421 zone)

EMBL: CP001509.YBBJ

CP001509.YBBJ        Location/Qualifiers
FT   CDS             complement(483548..484006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="ECD_00439"
FT                   /product="inner membrane protein; stimulator of the QmcA
FT                   suppressor of ftsH-htpX"
FT                   /note="similar to b0488"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42338"
FT                   /protein_id="ACT42338.2"
FT                   /translation="MMELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLV
FT                   VWLLPLGWEWQGVMFAILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLE
FT                   SPLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLHIRAVSS"
     MMELIVVHPH IFWLSLGGLL LAAEMLGGNG YLLWSGVAAV ITGLVVWLLP LGWEWQGVMF        60
     AILTLLAAWL WWKWLSRRVR EQKHSDSHLN QRGQQLIGRR FVLESPLVNG RGHMRVGDSS       120
     WPVSASEDLG AGTHVEVIAI EGITLHIRAV SS                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page