(data stored in ACNUC7421 zone)

EMBL: CP001509.YBBN

CP001509.YBBN        Location/Qualifiers
FT   CDS             complement(486572..487426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="ECD_00443"
FT                   /product="DnaK co-chaperone, thioredoxin-like protein"
FT                   /note="similar to b0492"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42342"
FT                   /protein_id="ACT42342.1"
FT                   /translation="MSVENIVNINESNLQQVLEQSMTTPVLFYFWSERSQHCLQLTPIL
FT                   ESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRA
FT                   LLDKVLPREEELKAQQAMQLMQESNYTDALPLLKDAWQLSNQNGEIGLLLAETLIALNR
FT                   SEDAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENPEDAALATQL
FT                   ALQLHQVGRNEEALELLFGHLRKDLTAADGQTRKTFQEILAALGTGDALASKYRRQLYA
FT                   LLY"
     MSVENIVNIN ESNLQQVLEQ SMTTPVLFYF WSERSQHCLQ LTPILESLAA QYNGQFILAK        60
     LDCDAEQMIA AQFGLRAIPT VYLFQNGQPV DGFQGPQPEE AIRALLDKVL PREEELKAQQ       120
     AMQLMQESNY TDALPLLKDA WQLSNQNGEI GLLLAETLIA LNRSEDAEAV LKTIPLQDQD       180
     TRYQGLVAQI ELLKQAADTP EIQQLQQQVA ENPEDAALAT QLALQLHQVG RNEEALELLF       240
     GHLRKDLTAA DGQTRKTFQE ILAALGTGDA LASKYRRQLY ALLY                        284
//

If you have problems or comments...

PBIL Back to PBIL home page