(data stored in ACNUC7421 zone)

EMBL: CP001509.YBCF

CP001509.YBCF        Location/Qualifiers
FT   CDS             519584..520477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="ECD_00471"
FT                   /product="putative carbonate kinase"
FT                   /note="similar to b0521"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42370"
FT                   /protein_id="ACT42370.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   LTRIEVSPDDPAFLQPEKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTEDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGTPQQRAIRHATPDELAPFAKADGSMGPKVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
     MKTLVVALGG NALLQRGEAL TAENQYRNIA SAVPALARLA RSYRLAIVHG NGPQVGLLAL        60
     QNLAWKEVEP YPLDVLVAES QGMIGYMLAQ SLSAQPQMPP VTTVLTRIEV SPDDPAFLQP       120
     EKFIGPVYQP EEQEALEAAY GWQMKRDGKY LRRVVASPQP RKILDSEAIE LLLKEGHVVI       180
     CSGGGGVPVT EDGAGSEAVI DKDLAAALLA EQINADGLVI LTDADAVYEN WGTPQQRAIR       240
     HATPDELAPF AKADGSMGPK VTAVSGYVRS RGKPAWIGAL SRIEETLAGE AGTCISL          297
//

If you have problems or comments...

PBIL Back to PBIL home page