(data stored in ACNUC7421 zone)

EMBL: CP001509.YBCI

CP001509.YBCI        Location/Qualifiers
FT   CDS             complement(525119..525640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="ECD_00477"
FT                   /product="DUF457 family inner membrane protein"
FT                   /note="similar to b0527"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42376"
FT                   /protein_id="ACT42376.1"
FT                   /translation="MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSF
FT                   NFGVAYGNVFGHRGFTHSLVFAFVVPLLCVLIGRRWFRAGLIRCWLFLTVSLLSHSLLN
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTAYGHQVIISELMWVWLPGML
FT                   LMGMLWWRRR"
     MPTVITHAAV PLCIGLGLGS KVIPPRLLFA GIILAMLPDA DVLSFNFGVA YGNVFGHRGF        60
     THSLVFAFVV PLLCVLIGRR WFRAGLIRCW LFLTVSLLSH SLLNSVTTGG KGVGWLWPWS       120
     DERFFAPWQV IKVAPFALSR YTTAYGHQVI ISELMWVWLP GMLLMGMLWW RRR              173
//

If you have problems or comments...

PBIL Back to PBIL home page