(data stored in ACNUC7421 zone)

EMBL: CP001509.YBCJ

CP001509.YBCJ        Location/Qualifiers
FT   CDS             complement(525748..525960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="ECD_00478"
FT                   /product="ribosome-associated protein; putative RNA-binding
FT                   protein"
FT                   /note="similar to b0528"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42377"
FT                   /protein_id="ACT42377.1"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAV
FT                   ETRKRCKIVAGQTVSFAGHSVQVVA"
     MATFSLGKHP HVELCDLLKL EGWSESGAQA KIAIAEGQVK VDGAVETRKR CKIVAGQTVS        60
     FAGHSVQVVA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page