(data stored in ACNUC7421 zone)

EMBL: CP001509.YBCL

CP001509.YBCL        Location/Qualifiers
FT   CDS             539488..540039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcL"
FT                   /locus_tag="ECD_00495"
FT                   /product="inactive polymorphonuclear leukocyte migration
FT                   suppressor; DLP12 prophage; UPF0098 family secreted
FT                   protein"
FT                   /note="similar to b0545"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42393"
FT                   /protein_id="ACT42393.1"
FT                   /translation="MKTLIVSTVLAFITFSAQAAAFQVTSNEIKTGEQLTTSHVFSGFG
FT                   CEGGNTSPSLTWSGVPEGTKSFAVTVYDPDAPTGSGWWHWTVVNIPATVTYLPVDAGRR
FT                   DGTKLPTGAVQGRNDFGYAGFGGACPPKGDKPHHYQFKVWALKTEKIPVDSNSSGALVG
FT                   YMLNANKIATAEITPVYEIK"
     MKTLIVSTVL AFITFSAQAA AFQVTSNEIK TGEQLTTSHV FSGFGCEGGN TSPSLTWSGV        60
     PEGTKSFAVT VYDPDAPTGS GWWHWTVVNI PATVTYLPVD AGRRDGTKLP TGAVQGRNDF       120
     GYAGFGGACP PKGDKPHHYQ FKVWALKTEK IPVDSNSSGA LVGYMLNANK IATAEITPVY       180
     EIK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page