(data stored in ACNUC7421 zone)

EMBL: CP001509.YBCO

CP001509.YBCO        Location/Qualifiers
FT   CDS             541679..541969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcO"
FT                   /locus_tag="ECD_00499"
FT                   /product="DLP12 prophage; uncharacterized protein"
FT                   /note="similar to b0549"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42397"
FT                   /protein_id="ACT42397.1"
FT                   /translation="MADLRKAARGRECQVRIPGVCNGNPETSVLAHIRLAGLCGTGIKP
FT                   PDLIATIACSACHDEIDRRTHFVDAGYAKECALEGMARTQVIWLKEGVIKA"
     MADLRKAARG RECQVRIPGV CNGNPETSVL AHIRLAGLCG TGIKPPDLIA TIACSACHDE        60
     IDRRTHFVDA GYAKECALEG MARTQVIWLK EGVIKA                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page