(data stored in ACNUC7421 zone)

EMBL: CP001509.YBDD

CP001509.YBDD        Location/Qualifiers
FT   CDS             592658..592855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /locus_tag="ECD_00566"
FT                   /product="DUF466 family protein"
FT                   /note="similar to b4512"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00566"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42444"
FT                   /protein_id="ACT42444.1"
FT                   /translation="MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
     MFDSLAKAGK YLGQAAKLMI GMPDYDNYVE HMRVNHPDQT PMTYEEFFRE RQDARYGGKG        60
     GARCC                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page