(data stored in ACNUC7421 zone)

EMBL: CP001509.YBDM

CP001509.YBDM        Location/Qualifiers
FT   CDS             complement(595223..595852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="ECD_00569"
FT                   /product="Spo0J family protein, ParB-like nuclease domain"
FT                   /note="similar to b0601"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42447"
FT                   /protein_id="ACT42447.1"
FT                   /translation="MGDTMQQRLTQDLTQFLASLPEDDRIKAINEIRMAIHQVSPFREE
FT                   PVDCVLWVKNDQLVPNDYNPNNVAPPEKKLLKKSIEIDGFTQPIVVTHTDKNALEIVDG
FT                   FHRHEIGKGSSSLKLRLKGYLPVTCLEGTRNQRIAATIRHNRARGRHQITAMSEIVREL
FT                   SQLGWDDNKIGKELGMDSDEVLRLKQINGLQELFADRQYSRAWTVK"
     MGDTMQQRLT QDLTQFLASL PEDDRIKAIN EIRMAIHQVS PFREEPVDCV LWVKNDQLVP        60
     NDYNPNNVAP PEKKLLKKSI EIDGFTQPIV VTHTDKNALE IVDGFHRHEI GKGSSSLKLR       120
     LKGYLPVTCL EGTRNQRIAA TIRHNRARGR HQITAMSEIV RELSQLGWDD NKIGKELGMD       180
     SDEVLRLKQI NGLQELFADR QYSRAWTVK                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page